Total number of results for Typhlonectes natans are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03924 |
SNPETMVSDVWWRESTENIPRSRFEDPSMW
|
30 | Typhlonectes natans | NPY | C-flanking peptide of NPY | ||
| NP03925 |
YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY
|
36 | Typhlonectes natans | NPY | Neuropeptide Y | 11287086#Ebersole T.J., Conlon J.M., Goetz F.W., Boyd S.K.; #Characterization and distribution of neuropeptide Y in the brain of a caecilian amphibian.; #Peptides 22:325-334(2001). |